The Compound Report is an educational resource. Nothing on this site constitutes medical advice or encourages personal use of any compound. Always consult a qualified healthcare provider.
Educational reference only. Nothing on this page constitutes medical advice or encourages personal use of this compound. Always consult a qualified healthcare provider before any decision involving your health.
LL-37 · hCAP18-Derived Peptide · CAMP
Effect demonstrated in multiple animal studies; human data sparse or extrapolated. Grades summarize evidence quality, not whether a compound is appropriate, legal, or risk-free.
Same compound, route-specific context. Switch forms instead of opening separate pages.
Use the route notes below to match form, goal, and evidence quality.
No route-matched protocol rows were parsed for this form; use the route notes and full dosing chapter before comparing options.
Open the full report at the dosing chapter for protocol rows, cycle context, and administration notes.
Human controlled evidence is topical/local chronic-wound LL-37 data such as venous leg ulcer and diabetic foot ulcer studies; systemic immune or injectable community use is not route-matched RCT evidence.
LL-37 is the only human cathelicidin — a 37-amino acid master coordinator of innate immunity, wound healing, and angiogenesis with genuine clinical trial evidence for topical wound healing and the most complex bidirectional cancer pharmacology of any compound in this reference.
The central tension resolved: LL-37's clinical evidence is real and concentrated in topical wound healing for LL-37-deficient chronic wounds — venous leg ulcers and diabetic foot ulcers. In that context, topical LL-37 is pharmacologically rational, evidence-supported, and well-tolerated. The 6-fold healing rate acceleration in the Grönberg 2014 VLU trial is a genuine and clinically meaningful result. No bacterial resistance development makes LL-37-based wound treatments particularly interesting for MRSA and multi-drug-resistant wound infections. The cancer paradox is the most critical safety issue and requires the most careful treatment: LL-37 is documented as pro-tumor in ovarian, breast, lung, melanoma, and prostate cancers through specific receptor-mediated mechanisms. Systemic injectable LL-37 for immune optimization distributes LL-37 to all tissues simultaneously, including potentially pre-malignant cells in cancer-relevant tissues, without the tissue-specific context control that physiological LL-37 production provides. The rosacea risk from excess LL-37 is real, mechanistically established, and can produce irreversible skin changes.
The practical guidance: the most evidence-supported, safest route to optimizing the cathelicidin arm of innate immunity is vitamin D optimization. Topical LL-37 for genuine LL-37-deficient chronic wound healing is the appropriate clinical application of the compound. Systemic injectable LL-37 for general immune optimization carries risks disproportionate to the evidence base supporting the use.
LL-37's discovery reflects the convergence of two major research programs in the 1990s: the characterization of human antimicrobial peptides as a distinct class of innate immune effectors, and the growing recognition that these peptides served functions far beyond simple bacterial killing. The compound that emerged from this research proved to be the most multifunctional host defense molecule ever characterized.
The cathelicidin family of antimicrobial peptides was identified in the early 1990s as a conserved group of proteins found in the granules of neutrophils and the epithelia of multiple mammalian species. The defining structural feature: all cathelicidins contain a conserved N-terminal 'cathelin' domain (named for its similarity to cathepsin L inhibitors) and a highly variable C-terminal antimicrobial domain that is cleaved by serine proteases to generate the active peptide. Human cells were found to contain only one cathelicidin — the gene CAMP (cathelicidin antimicrobial peptide) encoding the 18 kDa precursor protein hCAP18 — distinguishing humans from other mammals (mice have mCRAMP, cattle have BMAP-27/28, pigs have protegrins, sheep have OVB).
The active 37-amino acid C-terminal peptide was characterized in 1995 by Agerberth et al. and Turner et al. The peptide was named LL-37 for its two N-terminal leucine residues and 37-amino acid length. Its sequence: [LL-37, 37 aa] The peptide is strongly cationic (net charge +6 at physiological pH) and amphipathic — containing hydrophobic leucine/isoleucine-rich and hydrophilic lysine/arginine-rich faces. In aqueous solution it is largely unstructured; in contact with membranes (microbial or mammalian), it folds into an amphipathic alpha helix that is the structural basis for membrane interaction.
Initial characterization focused on antimicrobial activity — LL-37 killed bacteria through membrane disruption, consistent with its biophysical properties. But the research trajectory from the late 1990s through the 2010s revealed an extraordinary functional breadth that went far beyond antimicrobial action: angiogenesis, wound healing, chemotaxis, immunomodulation, anti-inflammatory signaling, adaptive immune bridge functions, and ultimately, cancer involvement. The original antimicrobial peptide turned out to be a master coordinator of tissue defense and repair.
THE CENTRAL TENSION
LL-37 is the only human cathelicidin — a 37-amino acid endogenous peptide that functions as antimicrobial, wound healer, angiogenic factor, immune modulator, and inflammatory coordinator simultaneously. It has genuine clinical trial evidence in chronic wound healing (venous leg ulcers, diabetic foot ulcers). It cannot develop bacterial resistance. It bridges innate and adaptive immunity in ways no conventional antibiotic can. And it is pro-tumor in ovarian, breast, lung, melanoma, and prostate cancers while being anti-tumor in colon and gastric cancers — the most bidirectional cancer pharmacology in this reference. Community users who take LL-37 for general immune optimization are administering a compound that, depending on whether they harbor any pre-malignant cells in ovary, breast, lung, or skin, may provide immune support or may provide growth signal to nascent tumors. The cancer paradox is not theoretical — it is documented in peer-reviewed oncology literature for multiple cancer types.
LL-37's cancer pharmacology cannot be summarized as simply pro-tumor or anti-tumor. It is both, depending on the cancer type, and the mechanisms are distinct for each direction. This chapter provides the most conservative and complete cancer risk framing of any compound in this reference.
Cancer Type
LL-37 Effect
Mechanism
Ovarian cancer
PRO-TUMOR
MSC (mesenchymal stem cell) recruitment via FPRL1 → tumor stroma formation; enhanced fibrovascular network; VEGF induction; tumor growth promotion. LL-37 overexpressed in ovarian tumors.
A — Coffelt et al. 2009 [6] PNAS; in vitro and in vivo; LL-37 neutralization reduces tumor growth
Breast cancer
PRO-TUMOR
EGFR transactivation → cell proliferation; invasion promotion; LL-37 overexpressed in breast tumor epithelium.
B — multiple in vitro + tumor histology studies
Lung cancer
PRO-TUMOR
Overexpressed in NSCLC; promotes invasion and angiogenesis.
B — tumor histology; cell line studies
Melanoma
PRO-TUMOR
LL-37 correlates positively with T stage (invasion depth); CXCL5/IL23A/MMP9 induction → invasion and angiogenesis. Ohuchi et al. 2023.
B — Ohuchi 2023 Cancers (correlation with T stage severity)
Prostate cancer
PRO-TUMOR
Overexpressed; knockdown reduces proliferation and invasive potential.
B — in vitro and in vivo knockdown studies
Colon cancer
ANTI-TUMOR
Apoptosis induction via mitochondrial pathway; tumor suppression. Underexpressed in colon tumors vs normal mucosa.
B — multiple in vitro and animal studies
Gastric cancer
ANTI-TUMOR
Apoptosis induction; tumor suppression; reduced expression in gastric tumors.
B — in vitro and animal models
THE ACTIVE MALIGNANCY POSITION — THE MOST NUANCED in this reference
LL-37's cancer pharmacology requires a more nuanced position than the standard 'active malignancy = contraindication' applied to growth factors in this reference. For compounds like IGF-LR3, the pro-tumor mechanism is one-directional and well-established; the contraindication is clear. For LL-37: (1) In ovarian, breast, lung, melanoma, and prostate cancers: the pro-tumor evidence is substantial — LL-37 is overexpressed in these tumors, and in vitro/in vivo studies show it promotes growth, invasion, and angiogenesis. Exogenous LL-37 in individuals with these cancers or a strong history of these cancers represents a meaningful risk. (2) In colon and gastric cancers: LL-37 shows anti-tumor activity — adding exogenous LL-37 could theoretically be beneficial (or at minimum not harmful). (3) For unknown malignancy: anyone with undetected early-stage ovarian, breast, lung, or melanoma cancer cannot be identified by available screening and might inadvertently receive pro-tumor stimulation. The practical position: active malignancy of ovarian, breast, lung, melanoma, or prostate type — do not use LL-37. Active colon or gastric cancer — the risk profile is different and requires oncologist evaluation. No active malignancy: the concern applies to theoretical subclinical pre-malignant lesions (which cannot be reliably excluded).
LL-37: 37 amino acids. Sequence: [LL-37, 37 aa] N-terminal LL (Leu-Leu). MW 4.5 kDa. Net charge +6 at physiological pH (cationic — drives electrostatic attraction to negatively charged bacterial membranes). Amphipathic alpha-helical secondary structure when in contact with membranes — hydrophobic face (Leu, Ile, Phe, Val residues) and hydrophilic face (Lys, Arg residues) allow simultaneous membrane insertion and aqueous phase interaction. Derived from the C-terminus of hCAP18 (18 kDa) by proteolytic cleavage: neutrophil proteinase 3 cleaves hCAP18 to release LL-37 in neutrophil extracellular environments; skin kallikrein 5 (KLK5) cleaves hCAP18 in skin; other proteases in other tissues. The cleavage site is precisely positioned to release the active helical antimicrobial domain.
LL-37 is produced in a tissue-specific and stimulus-dependent manner. Primary producing cells: neutrophils (stored pre-formed in secondary granules; released upon activation); keratinocytes (inducible, under microbial invasion, UV exposure, and vitamin D stimulation); macrophages (both constitutive and inducible); mast cells; NK cells; mucosal epithelial cells (respiratory, GI, genitourinary tract). Inducers of LL-37 expression: (1) Vitamin D3 (1,25-dihydroxyvitamin D3 / calcitriol) — the most potent physiological inducer; VDR binding directly transcribes the CAMP gene; this is why vitamin D deficiency is associated with increased susceptibility to infection — reduced endogenous LL-37; (2) Bacterial LPS, peptidoglycan, lipoteichoic acid — PAMPs that trigger innate immune expression; (3) Tissue injury, UV radiation, wounds; (4) Short-chain fatty acids (butyrate, propionate — produced by gut microbiome). Suppressors of LL-37: (1) Certain pathogenic bacteria actively suppress LL-37 expression (Staphylococcus aureus, some Streptococci); (2) Elevated cortisol/glucocorticoids reduce expression.
The direct transcriptional regulation of LL-37 by vitamin D is one of the most clinically important regulatory relationships in innate immunology. The CAMP gene promoter contains multiple vitamin D response elements (VDREs) that bind the VDR-RXR heterodimer to directly drive hCAP18/LL-37 transcription. Population studies consistently show that individuals with lower vitamin D status have lower LL-37 levels and higher susceptibility to respiratory infections, skin infections, and chronic wound complications. Intervention studies show that vitamin D supplementation in deficient individuals significantly increases LL-37 expression and antimicrobial capacity. The practical guidance: anyone considering exogenous LL-37 for immune support should first optimize their vitamin D status — targeting serum 25-OH vitamin D ≥60 ng/mL. This approach increases endogenous LL-37 production through the natural physiological pathway, avoids the cytotoxicity threshold concerns of exogenous LL-37, and avoids the cancer risk uncertainty.
LL-37 kills bacteria through direct disruption of the bacterial membrane — a fundamentally physical-chemical mechanism that is categorically different from all conventional antibiotic mechanisms (enzyme inhibition, protein synthesis disruption, DNA replication interference). The mechanism: (1) Electrostatic attraction: LL-37's net positive charge (+6) is attracted to the negatively charged bacterial membrane surface — composed of phosphatidylglycerol, cardiolipin, and lipopolysaccharide in Gram-negative bacteria; lipoteichoic acid in Gram-positive. Mammalian cell membranes are predominantly zwitterionic (phosphatidylcholine, sphingomyelin) and are less strongly attracted, providing the selectivity window. (2) Membrane insertion and disruption: the amphipathic helix inserts into the membrane with the hydrophobic face embedded in the lipid bilayer and the hydrophilic face in the aqueous phase; this disrupts membrane integrity; pore formation and membrane leakage cause rapid cell death. (3) Additional antimicrobial activities: LL-37 can sequester intracellular targets after membrane disruption; it disrupts lipid-enveloped viruses by the same membrane mechanism.
Standard antibiotics work by inhibiting specific bacterial enzymes or protein synthesis machinery — molecular targets where a single point mutation can confer resistance. LL-37's membrane disruption mechanism targets the entire lipid bilayer rather than a single protein, making resistance development much harder: any modification of the lipid bilayer sufficient to resist LL-37 disruption would likely impair bacterial viability itself. In serial passage experiments — the standard test for resistance potential — no bacterial resistance to LL-37 has been documented after more than 30 passages. This includes MRSA, which rapidly develops resistance to conventional antibiotics. This no-resistance property is one of the most clinically significant features of LL-37 and drives interest in its potential as a template for anti-infective development.
One of LL-37's most important antimicrobial properties is its ability to prevent biofilm formation at concentrations far below those required for direct bacterial killing (minimum inhibitory concentration, MIC). Overhage et al. (2008 [5], Infection and Immunity): LL-37 prevents Pseudomonas aeruginosa biofilm formation at 0.5 μg/mL — approximately 1/128 of the MIC. LL-37 kills established S. aureus biofilm bacteria within 5 minutes; vancomycin requires days to achieve comparable reductions and often fails to eradicate established biofilm entirely. The mechanism: LL-37 disrupts the quorum-sensing signaling that bacteria use to coordinate biofilm formation; it also penetrates the extracellular polysaccharide matrix of established biofilms better than most conventional antibiotics. Chronic wound infections are predominantly biofilm-associated — this is the mechanistic basis for LL-37's clinical application in chronic wounds that fail to respond to conventional antibiotics.
Pathogen Class
Activity
Evidence
Clinical Relevance
Gram-positive bacteria (S. aureus, MRSA, S. pyogenes, Enterococcus)
Bactericidal; membrane disruption
In vitro; animal wound models
MRSA wound infections; chronic wounds
Gram-negative bacteria (P. aeruginosa, E. coli, K. pneumoniae)
Bactericidal + anti-biofilm; LPS neutralization
In vitro; animal models
Chronic wound biofilms; hospital-acquired infections
Biofilm (all types)
Prevention and disruption at sub-MIC concentrations
Overhage 2008; multiple animal wound studies
Chronic wounds; implant-associated infections
Fungi (Candida spp., dermatophytes)
Fungicidal; membrane disruption
In vitro; some animal models
Skin and wound fungal infections
Enveloped viruses (influenza, RSV, HIV)
Disrupts lipid envelope; blocks entry
In vitro; Barlow 2011 influenza model
Respiratory infection defense; skin viral protection
Bacterial LPS (endotoxin)
Sequestration/neutralization
In vitro; animal sepsis models
LPS-driven inflammation reduction
Beyond killing bacteria, LL-37's immunomodulatory functions may be more clinically significant than its direct antimicrobial activity. The compound bridges innate and adaptive immunity in ways that conventional antibiotics cannot approach.
LL-37 activates FPRL1 (formyl peptide receptor-like 1, also known as FPR2) — a G-protein-coupled receptor expressed on neutrophils, monocytes, macrophages, and endothelial cells. FPRL1 activation by LL-37: stimulates neutrophil and monocyte chemotaxis (recruitment to sites of infection); activates dendritic cell maturation and antigen presentation; promotes macrophage phagocytosis; stimulates angiogenesis via VEGF induction in endothelial cells (Koczulla et al., 2003) [2]. The FPRL1-mediated chemotaxis explains how LL-37, released at sites of infection, coordinates the entire cellular arm of innate immunity — not just killing pathogens directly but recruiting the specialized immune cells needed for comprehensive defense and repair.
LL-37 has potent LPS (lipopolysaccharide) neutralizing activity. LPS — the outer membrane component of Gram-negative bacteria — is the primary trigger for the systemic inflammatory response that drives septic shock. LL-37 binds LPS with high affinity, sequestering it and preventing its interaction with TLR4 (the LPS recognition receptor) and CD14, blocking the NF-κB-mediated inflammatory cascade. This anti-LPS activity of LL-37 provides a mechanistic basis for its potential role in sepsis management. The anti-inflammatory property of LL-37 against LPS coexists with its pro-inflammatory EGFR transactivation and keratinocyte cytokine induction — context and concentration determine which predominates.
LL-37 drives multiple parallel pathways required for wound healing: (1) Re-epithelialization — LL-37 directly stimulates keratinocyte migration and proliferation, critical for wound closure; Heilborn et al. (2003) documented that LL-37 expression is upregulated in wound fluid during normal healing but is deficient in chronic, non-healing wounds — the observation that drove the clinical wound healing trials. (2) Angiogenesis — via FPRL1/VEGF signaling, LL-37 promotes new blood vessel formation to supply the healing tissue with oxygen and nutrients; Koczulla et al. (2003) demonstrated that mice deficient in the murine LL-37 analog (mCRAMP) showed decreased neovascularization of skin lesions; rabbit hind-limb ischemia models show LL-37 stimulates collateral vessel formation. (3) Fibroblast activation — LL-37 stimulates fibroblast proliferation and extracellular matrix deposition; provides structural scaffolding for tissue repair. (4) EGFR transactivation — LL-37 transactivates the epidermal growth factor receptor (EGFR) on keratinocytes, enhancing the proliferative response that drives wound closure. These four parallel wound healing mechanisms, combined with the anti-biofilm and antimicrobial activity, explain why LL-37-deficient chronic wounds fail to heal while LL-37-supplemented wounds show dramatically accelerated closure.
LL-37 promotes adaptive immune responses beyond the innate immune mechanisms: dendritic cell maturation and antigen-presenting capacity enhancement — critical for priming antigen-specific T and B cells; neutrophil survival prolongation — LL-37 inhibits neutrophil apoptosis, extending their functional lifespan at infection sites; T-cell and B-cell chemotaxis via FPRL1; facilitating the presentation of self-DNA to plasmacytoid dendritic cells, amplifying the interferon response to viral infection. The innate-to-adaptive immune bridge function is the most sophisticated and most therapeutically relevant of LL-37's non-antimicrobial activities — and the most context-dependent.
One of the more counterintuitive facts in LL-37 biology: while wound-healing literature treats low LL-37 as a problem to fix, dermatology literature identifies excessive LL-37 as the pathological mechanism of rosacea.
Rosacea is a chronic inflammatory skin condition affecting approximately 5% of adults, characterized by facial erythema (redness), telangiectasias (visible blood vessels), papules, and pustules. In normal skin, LL-37 is produced at low baseline levels by keratinocytes and is upregulated transiently during infection or injury. In rosacea-prone skin, two dysregulations combine: kallikrein 5 (KLK5), the serine protease that cleaves hCAP18 to LL-37 in the skin, is overactive — producing excess LL-37 from available hCAP18; CAMP expression is elevated, increasing hCAP18 substrate availability. The result: abnormally high local LL-37 concentrations in facial skin. High LL-37 activates TLR-2 on keratinocytes and mast cells → innate immune cascade → inflammatory cytokines (IL-8, IL-18, TNF-alpha) → vasodilation, recruitment of immune cells, neurogenic inflammation → the characteristic rosacea phenotype.
The mouse model confirmation: Yamasaki et al. and subsequent research groups documented that repeated injection of LL-37 into mouse skin at concentrations equivalent to those found in rosacea produces rosacea-like inflammatory lesions — erythema, telangiectasia, inflammatory infiltrate. The landmark concern for community users: one paper documented that long-term administration of LL-37 produced irreversible rosacea-like lesions. 'Irreversible' is the critical word. Community users of injectable LL-37 for immune support are administering a compound that, with extended or high-dose use, can produce permanent inflammatory skin changes. Individuals with pre-existing rosacea or rosacea-prone skin (fair-skinned individuals with frequent facial flushing, sun damage history) are specifically at risk.
The rosacea paradox has specific practical implications: (1) Anyone with a history of rosacea: LL-37 is specifically and mechanistically contraindicated; exogenous LL-37 adds to the already-excessive endogenous production that drives their condition. (2) Anyone with rosacea-prone phenotype (Fitzpatrick type I-II skin, frequent facial flushing, history of sun-induced facial redness): elevated concern; KLK5 activity may be constitutively elevated even in the absence of clinical rosacea. (3) Duration and dose: short-course low-dose topical LL-37 for wound healing is likely safe even in rosacea-prone individuals (the clinical context is controlled, not chronic); repeated systemic injection for general immune support is the concerning protocol.
LL-37's strongest human clinical evidence is concentrated in topical wound healing — a context mechanistically appropriate, therapeutically well-motivated, and supported by multiple controlled trials.
Grönberg A, Mahlapuu M, Ståhle M, Whately-Smith C, Rollman O. (2014 [3], Wound Repair and Regeneration): the first-in-man controlled trial of LL-37. Design: n=34 patients with venous leg ulcers (VLUs) that had failed to heal with standard compression treatment; 3-week open-label placebo run-in period to establish baseline; 4-week randomized, double-blind treatment phase with twice-weekly application of topical LL-37 at 0.5, 1.6, or 3.2 mg/mL vs placebo; 4-week follow-up. Primary endpoint: wound healing rate constant (area reduction). Results: 0.5 mg/mL LL-37 achieved approximately 6-fold higher healing rate constant vs placebo (p=0.003); 1.6 mg/mL achieved approximately 3-fold higher (p=0.088); 3.2 mg/mL showed less benefit than lower doses — a dose-dependent inverted-U effect consistent with LL-37's known biphasic biology. The 6-fold healing acceleration at the lowest dose is a clinically remarkable result. Safety: no serious adverse events; well-tolerated. Grade B: n=34; DBRPC; topical; Phase II design.
The HEAL LL-37 Phase IIb trial (multicenter, prospective, randomized, placebo-controlled) enrolled a larger VLU cohort to confirm the Phase I/II findings. Published circa 2022 in PMC (Wound Repair and Regeneration). The multicenter design addressed single-center bias from the Grönberg trial. Results: positive; confirmed the direction and clinical meaningfulness of topical LL-37 for VLU healing. Grade B — larger and more rigorous than Phase I/II; multicenter; confirms the wound healing signal.
Ahadieh et al. (2023 [4], Archives of Dermatological Research): Randomized, double-blind, controlled trial of LL-37 cream for diabetic foot ulcers (DFUs) with mild infection. DFUs are characterized by near-zero LL-37 expression in wound tissue — the low-expression chronic wound context that makes LL-37 replacement mechanistically appropriate. Results: LL-37 cream significantly improved wound healing rate, reduced IL-1α and TNF-alpha inflammatory cytokines in wound fluid, and reduced aerobic bacterial colonization vs placebo. Grade B — Indonesian multicenter; specific DFU population; objective wound measurement; positive outcomes.
| Indication | Grade | Best Evidence | Clinical Translation |
|---|---|---|---|
| Venous leg ulcer healing | B | Grönberg 2014 (n=34, 6x healing rate at 0.5 mg/mL, p=0.003); HEAL Phase IIb (multicenter positive) | Topical twice-weekly application; 4-week course; Phase III not yet completed |
| Diabetic foot ulcer healing | B | Jakarta RCT 2023; improved healing rate + reduced inflammation + reduced bacterial load | Topical cream; twice weekly; 4 weeks |
| MRSA/biofilm wound infection | B | Animal models; sub-MIC biofilm prevention; no resistance development | Strong preclinical; limited human controlled data for wound infection specifically |
| Systemic immune support | E | No controlled human trial; community use based on mechanism extrapolation | Grade E; not the tested application |
| Sepsis/LPS neutralization | C | LPS neutralization mechanism established; animal sepsis models positive | No completed human RCT for this indication |
| Topical rosacea treatment | D | Paradox — LL-37 CAUSES rosacea; research into blocking LL-37 for rosacea treatment | Contraindicated in rosacea context |
LL-37 becomes cytotoxic to mammalian cells at concentrations of approximately 1-10 μM (4.5-45 μg/mL). This threshold varies by cell type: keratinocytes are the most resistant (~10 μM); red blood cells (hemolysis) are more sensitive (~1-3 μM); immune cells intermediate. The therapeutic window for wound healing applications: the clinical trials used topical concentrations of 0.5-3.2 mg/mL (approximately 110-710 μM measured as stock concentration). At the wound surface, the local concentration is diluted by wound fluid and tissue — effective local concentrations in the nanomolar to low micromolar range. The 6x superior healing at 0.5 vs lower efficacy at 3.2 mg/mL in Grönberg 2014 is consistent with the cytotoxicity threshold beginning to affect keratinocyte function at higher concentrations. For injectable systemic LL-37: the systemic concentration achievable from community-dose injection could reach or approach cytotoxic thresholds in tissues, particularly in sites with less protein-binding dilution.
LL-37 shows a biphasic dose-response for many of its activities. Low concentrations (nanomolar): pro-healing, anti-biofilm, chemotactic, anti-inflammatory (LPS sequestration dominant). Intermediate concentrations (low micromolar): maximum wound healing stimulation; antimicrobial. High concentrations (approaching cytotoxic threshold): pro-inflammatory; cytotoxic; potentially pro-tumor amplification. This biphasic profile means that more LL-37 is not better. The 0.5 mg/mL clinical trial dose outperformed 3.2 mg/mL for wound healing — a real-world demonstration that dose optimization within the therapeutic window matters. Community protocols using high-dose injectable LL-37 may be operating in the wrong part of the dose-response curve.
The clinical trial evidence for LL-37 is entirely topical — applied directly to wound surfaces where local concentrations can be controlled and the compound is not absorbed systemically in meaningful amounts. Topical LL-37 for wound healing is pharmacologically appropriate: the compound is delivered to the LL-37-deficient chronic wound environment where low endogenous LL-37 is the problem. Injectable systemic LL-37 is a completely different pharmacological intervention: the compound distributes systemically, potentially exposing LL-37-sensitive tumor cells throughout the body, reaching the skin (rosacea risk), and potentially achieving cytotoxic concentrations in some tissues. The community use of injectable LL-37 for 'immune support' does not correspond to any of the controlled clinical trial contexts and adds the cancer and rosacea risks described above. The injectable route should be approached with significantly more caution than the clinical topical use.
LL-37 is susceptible to proteolytic degradation by multiple peptidases present in tissues and body fluids. In chronic wound environments, excess protease activity (MMP-2, MMP-9, elastase) can degrade exogenous LL-37 rapidly — one of the practical challenges for topical wound healing applications. In cystic fibrosis, LL-37 is inactivated by interaction with DNA, F-actin, and mucins present in the airways — explaining reduced antimicrobial defense in CF patients despite normal production. For community injectable use, plasma proteases limit the effective half-life of circulating LL-37. Stability of reconstituted LL-37 is limited: reconstituted solution should be stored at -20°C and used promptly; repeated freeze-thaw cycles degrade the peptide.
For the community user interested in supporting their cathelicidin immune system, the most evidence-based, safest, and most physiologically appropriate intervention is not exogenous LL-37 injection but vitamin D optimization.
The vitamin D-CAMP gene axis is the primary regulatory pathway for endogenous LL-37 production in human tissues. Vitamin D deficiency — which is endemic in modern populations (estimated 40-50% of adults globally are below optimal levels) — directly reduces LL-37 expression in skin, respiratory epithelium, and immune cells, impairing innate immune defense. Multiple intervention studies document that vitamin D supplementation in deficient individuals: increases LL-37 expression in keratinocytes and macrophages; reduces respiratory infection frequency and severity; improves response to respiratory pathogens including influenza and SARS-CoV-2; enhances wound healing in diabetic patients. Specifically: a 2009 study in hospitalized patients showed that vitamin D-sufficient patients had dramatically better surgical infection outcomes, correlating with LL-37 levels. The Martineau 2017 BMJ meta-analysis of 25 RCTs (n=11,321) showed vitamin D supplementation reduced acute respiratory infection risk, with the most benefit in deficient individuals — consistent with vitamin D → LL-37 → mucosal defense pathway restoration.
The practical comparison: for a community user who wants to optimize their cathelicidin immune defense, oral vitamin D3 supplementation to achieve serum 25-OH vitamin D of 60-80 ng/mL: safely increases endogenous LL-37 across all tissues simultaneously; produces LL-37 in appropriate tissue-specific concentrations under physiological regulation (not bypassing the concentration control mechanisms that prevent excess); costs pennies per day; has no cancer risk or rosacea risk; has decades of safety data. Exogenous injectable LL-37: bypasses physiological concentration regulation; introduces systemic LL-37 without tissue-specific context; carries cancer risk in multiple tumor types; carries rosacea risk; costs orders of magnitude more; has no controlled systemic human safety data. The Vitamin D3 strategy is the correct clinical choice for immune optimization through the LL-37 pathway.
Partially true, substantially misleading. LL-37 coordinates innate and adaptive immune responses at wound sites and mucosal surfaces — this is genuine immune function. But the systemic effects of exogenous LL-37 are not simply 'boost immunity.' It recruits immune cells, stimulates angiogenesis, activates inflammatory pathways, and — most importantly — provides pro-tumor signals in multiple cancer-relevant tissues. 'Immune booster' framing omits the most important safety information about the compound.
Endogenous does not mean safe at exogenous doses. Cortisol is endogenous — supraphysiological cortisol causes Cushing's syndrome. LL-37 is endogenous — supraphysiological LL-37 causes rosacea and may promote multiple tumor types. The endogenous status establishes that the molecule has physiological functions; it does not establish that exogenously administered LL-37 at doses or in compartments different from physiological production is safe.
The no-resistance property is genuinely important and motivates substantial pharmaceutical research into LL-37-based drug development. But LL-37 is not currently approved as an antibiotic. Its cytotoxicity threshold limits systemic antibiotic use; its cancer risk profile limits chronic systemic use. The pharmaceutical development direction is LL-37 analogs and fragments with retained antimicrobial activity but reduced cytotoxicity and eliminated pro-tumor properties. Community use of LL-37 as a systemic antibiotic alternative is pharmacologically premature.
The clinical trial evidence (Grönberg 2014; HEAL Phase IIb; Jakarta DFU) is for topical wound healing in LL-37-deficient chronic wounds. Topical application to an LL-37-deficient wound is pharmacologically rational — replacing a locally deficient signaling molecule in the tissue where it is needed. Systemic injection for general immune optimization is pharmacologically different: LL-37 is delivered to all tissues simultaneously, not to a specific LL-37-deficient wound, and the cancer and rosacea risks apply throughout. These are not equivalent applications.
Agerberth B, Charo J, Werr J et al. (2000) [1]. The human antimicrobial and chemotactic peptides LL-37 and alpha-defensins are expressed by specific lymphocyte and monocyte populations. Blood. 96(9):3086-3093. [Characterization of LL-37 expression in immune cell populations; tissue distribution.]
Koczulla AR, von Degenfeld G, Kupatt C et al. (2003). An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. Journal of Clinical Investigation. 111(11):1665-1672. [The definitive angiogenesis mechanism paper; FPRL1/VEGF pathway; ischemia models; mCRAMP knockout mice.]
Grönberg A, Mahlapuu M, Ståhle M, Whately-Smith C, Rollman O. (2014). Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair and Regeneration. 22(5):613-621. [n=34; DBRPC; 0.5 mg/mL: 6x healing rate, p=0.003. The landmark Phase I/II wound healing trial.]
Ahadieh S et al. (2023). Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcer: a randomized double-blind controlled trial. Archives of Dermatological Research. PMC10514151. [DBRCT; DFU; improved healing rate + reduced IL-1α/TNF-α + reduced bacterial load; second positive RCT for LL-37 wound healing.]
Overhage J, Campisano A, Bains M, Torfs EC, Rehm BH, Hancock RE. (2008). Human host defense peptide LL-37 prevents bacterial biofilm formation. Infection and Immunity. 76(9):4176-4182. PMID 18591225. [Sub-MIC biofilm prevention at 1/128 of MIC; Pseudomonas; no resistance development after 30 passages.]
Coffelt SB, Marini FC, Watson K et al. (2009). The pro-inflammatory peptide LL-37 promotes ovarian tumor progression through recruitment of multipotent mesenchymal stromal cells. Proceedings of the National Academy of Sciences USA. 106(10):3806-3811. PMC2656161. [The foundational pro-tumor paper; MSC recruitment via FPRL1; in vivo tumor growth; LL-37 neutralization reduces tumor growth. Key ovarian cancer evidence.]
Ouhara K, Komatsuzawa H, Yamada S et al. (2005) [7]. Susceptibilities of periodontopathogenic and cariogenic bacteria to antibacterial peptides including LL-37 produced by human epithelial cells. Journal of Antimicrobial Chemotherapy. [Comprehensive antimicrobial spectrum data.]
Yamasaki K, Di Nardo A, Bardan A et al. (2007) [8]. Increased serine protease activity and cathelicidin promotes skin inflammation in rosacea. Nature Medicine. 13(8):975-980. [The definitive rosacea mechanism paper; KLK5 overactivity → excess LL-37 → TLR-2 → rosacea inflammatory cascade.]
Gombart AF, Borregaard N, Koeffler HP. (2005) [9]. Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3. FASEB Journal. 19(9):1067-1077. [The definitive vitamin D-CAMP gene transcription paper; VDR direct binding; the mechanistic basis for vitamin D supplementation as a strategy to enhance LL-37 production.]
LL-37 is the only human cathelicidin — a 37-amino acid master coordinator of innate immunity, wound healing, and angiogenesis with genuine clinical trial evidence for topical wound healing and the most complex bidirectional cancer pharmacology of any compound in this reference.
The central tension resolved: LL-37's clinical evidence is real and concentrated in topical wound healing for LL-37-deficient chronic wounds — venous leg ulcers and diabetic foot ulcers. In that context, topical LL-37 is pharmacologically rational, evidence-supported, and well-tolerated. The 6-fold healing rate acceleration in the Grönberg 2014 VLU trial is a genuine and clinically meaningful result. No bacterial resistance development makes LL-37-based wound treatments particularly interesting for MRSA and multi-drug-resistant wound infections. The cancer paradox is the most critical safety issue and requires the most careful treatment: LL-37 is documented as pro-tumor in ovarian, breast, lung, melanoma, and prostate cancers through specific receptor-mediated mechanisms. Systemic injectable LL-37 for immune optimization distributes LL-37 to all tissues simultaneously, including potentially pre-malignant cells in cancer-relevant tissues, without the tissue-specific context control that physiological LL-37 production provides. The rosacea risk from excess LL-37 is real, mechanistically established, and can produce irreversible skin changes.
The practical guidance: the most evidence-supported, safest route to optimizing the cathelicidin arm of innate immunity is vitamin D optimization. Topical LL-37 for genuine LL-37-deficient chronic wound healing is the appropriate clinical application of the compound. Systemic injectable LL-37 for general immune optimization carries risks disproportionate to the evidence base supporting the use.
LL-37 is the only human cathelicidin — a 37-amino acid master coordinator of innate immunity, wound healing, and angiogenesis with genuine clinical trial evidence for topical wound healing and the most complex bidirectional cancer pharmacology of any compound in this reference.
The central tension resolved: LL-37's clinical evidence is real and concentrated in topical wound healing for LL-37-deficient chronic wounds — venous leg ulcers and diabetic foot ulcers. In that context, topical LL-37 is pharmacologically rational, evidence-supported, and well-tolerated. The 6-fold healing rate acceleration in the Grönberg 2014 VLU trial is a genuine and clinically meaningful result. No bacterial resistance development makes LL-37-based wound treatments particularly interesting for MRSA and multi-drug-resistant wound infections. The cancer paradox is the most critical safety issue and requires the most careful treatment: LL-37 is documented as pro-tumor in ovarian, breast, lung, melanoma, and prostate cancers through specific receptor-mediated mechanisms. Systemic injectable LL-37 for immune optimization distributes LL-37 to all tissues simultaneously, including potentially pre-malignant cells in cancer-relevant tissues, without the tissue-specific context control that physiological LL-37 production provides. The rosacea risk from excess LL-37 is real, mechanistically established, and can produce irreversible skin changes.
The practical guidance: the most evidence-supported, safest route to optimizing the cathelicidin arm of innate immunity is vitamin D optimization. Topical LL-37 for genuine LL-37-deficient chronic wound healing is the appropriate clinical application of the compound. Systemic injectable LL-37 for general immune optimization carries risks disproportionate to the evidence base supporting the use.
— End of LL-37 —
THE PEPTIDE BIBLE | LL-37 | For Research & Educational Purposes Only
LL-37 (Cathelicidin): the only human cathelicidin. 37 amino acids: [LL-37, 37 aa] MW 4.5 kDa. Net charge +6 (cationic). Amphipathic alpha-helix when membrane-associated. Derived from C-terminus of hCAP18 by proteinase 3 (neutrophils) or kallikrein 5 (skin). Produced by neutrophils, macrophages, keratinocytes, epithelial cells, NK cells, mast cells. INDUCTION: Vitamin D3 (most potent — VDR directly transcribes CAMP gene); bacterial PAMPs; tissue injury; butyrate. ANTIMICROBIAL: membrane disruption (electrostatic attraction to negatively charged bacterial membranes → amphipathic helix insertion → lysis); broad-spectrum (Gram-positive, Gram-negative, fungi, enveloped viruses); NO bacterial resistance after 30+ serial passages; anti-biofilm at 1/128 of MIC (Overhage 2008). IMMUNOMODULATORY: FPRL1/FPR2 → chemotaxis (neutrophils, monocytes, lymphocytes); DC maturation; macrophage activation; adaptive immune bridge; LPS sequestration (blocks TLR4 → anti-inflammatory); EGFR transactivation (→ keratinocyte proliferation); neutrophil apoptosis inhibition. WOUND HEALING: keratinocyte migration/proliferation; angiogenesis via FPRL1/VEGF (Koczulla 2003); fibroblast activation; re-epithelialization; deficient in chronic non-healing wounds. CANCER PARADOX (bidirectional): PRO-TUMOR: ovarian (Coffelt 2009 PNAS — MSC recruitment, tumor growth), breast, lung, melanoma (Ohuchi 2023 — T stage correlation), prostate. ANTI-TUMOR: colon, gastric (apoptosis induction). ACTIVE MALIGNANCY: contraindicated for ovarian/breast/lung/melanoma/prostate; mechanism-specific opposite risk for colon/gastric. ROSACEA PARADOX: excess LL-37 (from overactive KLK5 → TLR-2 → inflammation) CAUSES rosacea. Long-term LL-37 administration produces irreversible rosacea-like lesions in mice. Contraindicated in rosacea patients; risk for rosacea-prone skin. CYTOTOXICITY: ~1-10 μM (4.5-45 μg/mL) for mammalian cells; dose-dependent; biphasic dose-response (inverted-U); 0.5 mg/mL > 3.2 mg/mL for wound healing in clinical trial. CLINICAL EVIDENCE: Grönberg 2014 (n=34 VLU, DBRPC, 0.5 mg/mL: 6x healing rate, p=0.003 — B); HEAL Phase IIb (multicenter VLU, positive — B); Jakarta DFU RCT 2023 (positive — B). Systemic immune optimization: Grade E. VITAMIN D STRATEGY: oral vitamin D3 to 60-80 ng/mL 25-OH vitamin D is the evidence-based, safe alternative for cathelicidin immune optimization; Martineau 2017 BMJ meta-analysis (n=11,321, reduced respiratory infections). INJECTABLE SYSTEMIC: not supported by clinical evidence; cancer and rosacea risks; cytotoxicity concerns; vitamin D is the correct alternative.
Adds KPV’s local gut anti-inflammatory signal to the GLOW recovery-and-skin stack.
Alpha-MSH's Anti-Inflammatory Fragment — And It May Work Completely Differently Than Everyone Thinks
Scope appropriateness is the question: local gut peptides are being stacked for barrier integrity and inflammatory signaling, not for systemic regeneration claims.